Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
ILIIFLISIPLQNSSFYLAKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHP TLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHH CLL | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | 5prime_partial | 209 | 731-102(-) |
Amino Acid sequence : | |||
EEAVVHRQLHLADDVEAVTEEQIVIPMNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDY VKRRVTVDDGDAVGALLGVLLLRLHLASEYRARALPFVTRPAYLTGAEAQTGGGGGVETGIDVGGVETRGALDESWSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | 5prime_partial | 100 | 732-430(-) |
Amino Acid sequence : | |||
RGGSGAQAAAPRRRCGGGDGGADRNSDESNLQANSPPATPLDLRSRAPPLETPPQIDRTESPRSQDTPYRRRLHCTRRGRLGKRRAAARRASAPGRGRRC* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
ILIIFLISIPLQNSSFYLAKMHSLNSTALDLKSLIRPPPIHHRLAAAPRLIQCASRFDSTNVNSSFNPATTTGLSLGSGQVGRARYEWQSACSILASKVESQQQDTEKSADGVSVVNGHP TLDIVPIKEQSNSPAPAPLPKPLSIADLSPAPMHGAQLRVAYQGVPGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHH CLL | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | 5prime_partial | 209 | 731-102(-) |
Amino Acid sequence : | |||
EEAVVHRQLHLADDVEAVTEEQIVIPMNRTSKRILHRQHRSICDPELHRLKRHLKLIARNRLAVRIRLTGGGFTVRAGDALVSDAQLRAVHRRRGEVGDAERLRERRRRWRVRLLFDWDY VKRRVTVDDGDAVGALLGVLLLRLHLASEYRARALPFVTRPAYLTGAEAQTGGGGGVETGIDVGGVETRGALDESWSGGEAVVDRRRPD* | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342110.1 | 5prime_partial | 100 | 732-430(-) |
Amino Acid sequence : | |||
RGGSGAQAAAPRRRCGGGDGGADRNSDESNLQANSPPATPLDLRSRAPPLETPPQIDRTESPRSQDTPYRRRLHCTRRGRLGKRRAAARRASAPGRGRRC* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,795.842 | ||
Theoretical pI: | 11.760 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 105.987 | ||
aromaticity | 0.010 | ||
GRAVY | -1.375 | ||
Secondary Structure Fraction | |||
Helix | 0.080 | ||
turn | 0.340 | ||
sheet | 0.220 |