| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342122.1 | complete | 125 | 461-84(-) |
Amino Acid sequence : | |||
| MDEYKKGALVFGGYLKGATVFLVGIEGEDSLPKQDFDWIANCPPIFQIFEIFSRTMGDLAGHGKEQKIPAVGWYMNEHGCSEMEGFRELWKQVEKAWKNLNDERKKVQVTFVEVFASIVN LARVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,916.683 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.760 | ||
| aromaticity | 0.168 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.308 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342122.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
| GSPSKNLIKGLFVGGESVYPSSPEKYFAYETRAKFTMLAKTSTNVTCTFFLSSFKFFHAFSTCFQSSLKPSISEHPCSFMYQPTAGIFCSFPWPAKSPIVLEKISKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,916.683 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.760 | ||
| aromaticity | 0.168 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.308 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342122.1 | complete | 125 | 461-84(-) |
Amino Acid sequence : | |||
| MDEYKKGALVFGGYLKGATVFLVGIEGEDSLPKQDFDWIANCPPIFQIFEIFSRTMGDLAGHGKEQKIPAVGWYMNEHGCSEMEGFRELWKQVEKAWKNLNDERKKVQVTFVEVFASIVN LARVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,916.683 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.760 | ||
| aromaticity | 0.168 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.308 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342122.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
| GSPSKNLIKGLFVGGESVYPSSPEKYFAYETRAKFTMLAKTSTNVTCTFFLSSFKFFHAFSTCFQSSLKPSISEHPCSFMYQPTAGIFCSFPWPAKSPIVLEKISKI* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,916.683 | ||
| Theoretical pI: | 9.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 41.760 | ||
| aromaticity | 0.168 | ||
| GRAVY | 0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.308 | ||
| sheet | 0.178 | ||