| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342123.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| DMFHSLHPAADYHAAARAVGGCAIYVSDKPGHHNFDLLKKLVLPDGSVLRAQLPGRPTIDCLFVDPARDGTSLLKIWNANKCSGVVGVFNCQGAGWCRIAKKTRIHDASPGTLTGSVQAV DVDCIAQIGGADWDGEVVVYAYRSGEVLRLPKGASLPVTLKVLEYELFHIYPLEKITEDISFAPIGLLDMFNP | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 15,258.206 | ||
| Theoretical pI: | 10.660 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 73.545 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.312 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342123.1 | complete | 138 | 511-95(-) |
Amino Acid sequence : | |||
| MWKSSYSRTLSVTGSEAPLGKRSTSPDLYAYTTTSPSQSAPPICAMQSTSTAWTEPVRVPGEASWMRVFFAILHHPAPWQLNTPTTPEHLFAFQILSKLVPSLAGSTKRQSIVGRPGSCA RRTDPSGRTSFFRRSKLW* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,258.206 | ||
| Theoretical pI: | 10.660 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 73.545 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.312 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342123.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| DMFHSLHPAADYHAAARAVGGCAIYVSDKPGHHNFDLLKKLVLPDGSVLRAQLPGRPTIDCLFVDPARDGTSLLKIWNANKCSGVVGVFNCQGAGWCRIAKKTRIHDASPGTLTGSVQAV DVDCIAQIGGADWDGEVVVYAYRSGEVLRLPKGASLPVTLKVLEYELFHIYPLEKITEDISFAPIGLLDMFNP | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 15,258.206 | ||
| Theoretical pI: | 10.660 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 73.545 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.312 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342123.1 | complete | 138 | 511-95(-) |
Amino Acid sequence : | |||
| MWKSSYSRTLSVTGSEAPLGKRSTSPDLYAYTTTSPSQSAPPICAMQSTSTAWTEPVRVPGEASWMRVFFAILHHPAPWQLNTPTTPEHLFAFQILSKLVPSLAGSTKRQSIVGRPGSCA RRTDPSGRTSFFRRSKLW* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,258.206 | ||
| Theoretical pI: | 10.660 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 73.545 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.312 | ||
| sheet | 0.203 | ||