Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | internal | 204 | 2-613(+) |
Amino Acid sequence : | |||
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDL | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | 5prime_partial | 153 | 613-152(-) |
Amino Acid sequence : | |||
QIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVE NSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | internal | 204 | 2-613(+) |
Amino Acid sequence : | |||
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDL | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | 5prime_partial | 153 | 613-152(-) |
Amino Acid sequence : | |||
QIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVE NSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342127.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 15,638.533 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 93.328 | ||
aromaticity | 0.033 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.153 | ||
turn | 0.420 | ||
sheet | 0.173 |