| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342129.1 | 5prime_partial | 136 | 3-413(+) |
Amino Acid sequence : | |||
| NDAQQTMTALKSATQELKGMMKTVNIQDIDNLQDEMMDLMDVSNEIQESLGRSYNVPDDIDEDELLGELDALEADMGFETEGDGVPAYLQPDKESDLDSELNLPSAPSGHAPYPAGRAQG EDELGLPAVPQASLRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,695.885 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 54.590 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.656 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.257 | ||
| sheet | 0.360 | ||