Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342134.1 | 5prime_partial | 246 | 805-65(-) |
Amino Acid sequence : | |||
TYDNYAPVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEA IDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYTRNNGDGYTDPSFAKSNITALF VDPIII* | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 28,652.323 | ||
Theoretical pI: | 4.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 56965 | ||
Instability index: | 39.146 | ||
aromaticity | 0.138 | ||
GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.207 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342134.1 | 5prime_partial | 246 | 805-65(-) |
Amino Acid sequence : | |||
TYDNYAPVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEA IDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYTRNNGDGYTDPSFAKSNITALF VDPIII* | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 28,652.323 | ||
Theoretical pI: | 4.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56840 56965 | ||
Instability index: | 39.146 | ||
aromaticity | 0.138 | ||
GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.207 | ||
sheet | 0.240 |