Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342137.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
HTLSATMPSVPGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPEVEGAKNVIRAAAEAK VRRVVLTSSIGAIYMDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILL FENPAASGRYLC | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,431.115 | ||
Theoretical pI: | 5.447 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35785 | ||
Instability index: | 25.259 | ||
aromaticity | 0.067 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.210 | ||
sheet | 0.290 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342137.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
HTLSATMPSVPGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTARNPDDPKNSHLRELEGADERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPEVEGAKNVIRAAAEAK VRRVVLTSSIGAIYMDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILL FENPAASGRYLC | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,431.115 | ||
Theoretical pI: | 5.447 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35785 | ||
Instability index: | 25.259 | ||
aromaticity | 0.067 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.210 | ||
sheet | 0.290 |