| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342138.1 | complete | 204 | 683-69(-) |
Amino Acid sequence : | |||
| MDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILLFENPAASGRYLCTE SVLHRGEVVEILAKLFPEYPIPTKCSDEKSPRTKPYKFSNQKLKDLGMEFTPVKQSLYDTVKSLREKGHLPIPNQNEEPISIQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 11,259.771 | ||
| Theoretical pI: | 10.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 30.700 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.313 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342138.1 | complete | 99 | 109-408(+) |
Amino Acid sequence : | |||
| MGRCPFSRRLFTVSYKLCFTGVNSIPKSFSFWFENLYGFVLGLFSSEHLVGIGYSGNNLARISTTSPRWRTLSVQRYRPDAAGFSNKRMWARATSLTST* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,259.771 | ||
| Theoretical pI: | 10.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 30.700 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.313 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342138.1 | complete | 204 | 683-69(-) |
Amino Acid sequence : | |||
| MDPNRDPDKVVDETCWSDLEFCKSTKNWYCYGKAVAEQAAWETAREVGVDLVVLKPVLVLGSLLQPTVNASVLHILKYLIGSAKTYANSIQAYVDVKDVALAHILLFENPAASGRYLCTE SVLHRGEVVEILAKLFPEYPIPTKCSDEKSPRTKPYKFSNQKLKDLGMEFTPVKQSLYDTVKSLREKGHLPIPNQNEEPISIQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 11,259.771 | ||
| Theoretical pI: | 10.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 30.700 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.313 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342138.1 | complete | 99 | 109-408(+) |
Amino Acid sequence : | |||
| MGRCPFSRRLFTVSYKLCFTGVNSIPKSFSFWFENLYGFVLGLFSSEHLVGIGYSGNNLARISTTSPRWRTLSVQRYRPDAAGFSNKRMWARATSLTST* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,259.771 | ||
| Theoretical pI: | 10.922 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 30.700 | ||
| aromaticity | 0.162 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.313 | ||
| sheet | 0.182 | ||