| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342140.1 | 5prime_partial | 213 | 777-136(-) |
Amino Acid sequence : | |||
| ETPVSAVSIRRIPGVPADMPLYDILNEFQKGSSHMAAVVRPKGQNKRPPSIMEKAEESEATNGDSDVTTPLLSKKEDKADSIIVDIEKVSRPPSKPNLTYNDAVANVLAAQDDSEDGEVI GIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSVRRLTSKGAGSQYKLGQTQKKAGEDEATSAKLQGNAGENVPAGGKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 19,944.526 | ||
| Theoretical pI: | 4.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26720 | ||
| Instability index: | 64.444 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.477 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.330 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342140.1 | complete | 191 | 119-694(+) |
Amino Acid sequence : | |||
| MPLMNHHLLPPAGTFSPALPCNFADVASSSPAFFCVCPSLYWDPAPLDVNLLTDGARATDEAAAAAATRILLWTSTYSSVSSTISSCRSSSNTSSKVIMPITSPSSESSCAAKTFATASL YVRLGLDGGLETFSMSTMILSALSSFFDSNGVVTSESPFVASLSSAFSMIDGGLLFWPLGLTTAAIWLLPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 19,944.526 | ||
| Theoretical pI: | 4.502 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26720 | ||
| Instability index: | 64.444 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.477 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.330 | ||
| sheet | 0.293 | ||