Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342162.1 | complete | 122 | 218-586(+) |
Amino Acid sequence : | |||
MARVPTVTAVTTTATASETTVTTAIPSTAASAITTFTASIAAAAPSITTSTSVTSWTTESTASTTPASAGLSFVDGDVPAVQFLTVHPLNCVPHRLLILKGNESEASRPSGLAIIDDRFR VK* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 9,996.226 | ||
Theoretical pI: | 9.291 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 69.507 | ||
aromaticity | 0.087 | ||
GRAVY | -1.213 | ||
Secondary Structure Fraction | |||
Helix | 0.125 | ||
turn | 0.567 | ||
sheet | 0.096 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342162.1 | complete | 104 | 499-185(-) |
Amino Acid sequence : | |||
MRDAIEGMNGQELDGRNITVNEAQSRGSGGGGGGGFRGPRRDGGGGGYGGGGGGYGRREGGYGGGGGGGYGRRDGGFGGGGRGGYGGDRGYSSHGGDSEGNWRS* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 9,996.226 | ||
Theoretical pI: | 9.291 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 69.507 | ||
aromaticity | 0.087 | ||
GRAVY | -1.213 | ||
Secondary Structure Fraction | |||
Helix | 0.125 | ||
turn | 0.567 | ||
sheet | 0.096 |