| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342162.1 | complete | 122 | 218-586(+) |
Amino Acid sequence : | |||
| MARVPTVTAVTTTATASETTVTTAIPSTAASAITTFTASIAAAAPSITTSTSVTSWTTESTASTTPASAGLSFVDGDVPAVQFLTVHPLNCVPHRLLILKGNESEASRPSGLAIIDDRFR VK* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 9,996.226 | ||
| Theoretical pI: | 9.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 69.507 | ||
| aromaticity | 0.087 | ||
| GRAVY | -1.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.125 | ||
| turn | 0.567 | ||
| sheet | 0.096 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342162.1 | complete | 104 | 499-185(-) |
Amino Acid sequence : | |||
| MRDAIEGMNGQELDGRNITVNEAQSRGSGGGGGGGFRGPRRDGGGGGYGGGGGGYGRREGGYGGGGGGGYGRRDGGFGGGGRGGYGGDRGYSSHGGDSEGNWRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 9,996.226 | ||
| Theoretical pI: | 9.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 69.507 | ||
| aromaticity | 0.087 | ||
| GRAVY | -1.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.125 | ||
| turn | 0.567 | ||
| sheet | 0.096 | ||