| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342166.1 | 5prime_partial | 210 | 2-634(+) |
Amino Acid sequence : | |||
| LTFKARYEPDKAAAPATVSLNAGDFKLRASLTDATIVNGPTLNGLALAVEKPGFFIVDYNVPKKDVRFQFMNTIRVAEKPLNLTYIHSKGEERTILDGALVIDSANKVSANHVLGTANTK LKYTYVHGGASTFEPSYDLGKNAWDFPVSHKLYQDDVFRATYQTSSKNLGLEWTRSSKQHGSFKIIASVNLAEERKIPKLSAETTWDFEI* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 23,303.091 | ||
| Theoretical pI: | 8.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 16.928 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.229 | ||
| sheet | 0.248 | ||