| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342168.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| TSDPIYFSHPMALQVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALYWGPGGGPDLI | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 14,375.592 | ||
| Theoretical pI: | 4.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 32.063 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.382 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342168.1 | 5prime_partial | 144 | 440-6(-) |
Amino Acid sequence : | |||
| DQIGAAAGAPVEGALGAPPVLLQGLSFPREHGSAVAGDGGGSVVLSREDVAGAPSDLSAEGSEGLNQDGGLDGHVEAASDSGALEGLRGPELGPAGHEARHFDLGELDLEAAEVGLGHVL DLVLAAGVGLLDLERHRVREIDWI* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,375.592 | ||
| Theoretical pI: | 4.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 32.063 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.382 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342168.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| TSDPIYFSHPMALQVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALYWGPGGGPDLI | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 14,375.592 | ||
| Theoretical pI: | 4.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 32.063 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.382 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342168.1 | 5prime_partial | 144 | 440-6(-) |
Amino Acid sequence : | |||
| DQIGAAAGAPVEGALGAPPVLLQGLSFPREHGSAVAGDGGGSVVLSREDVAGAPSDLSAEGSEGLNQDGGLDGHVEAASDSGALEGLRGPELGPAGHEARHFDLGELDLEAAEVGLGHVL DLVLAAGVGLLDLERHRVREIDWI* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,375.592 | ||
| Theoretical pI: | 4.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 32.063 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.299 | ||
| sheet | 0.382 | ||