| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342178.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| PFLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRD GSVLMSVSLDQLKAPELLYKSLATKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVITPLSEQLTKPLPNALALVTLKELSSGAHQLLPEGTRLAVSVRGDESHEELD ILKTTDATMILHHIPYSDDKT | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,894.849 | ||
| Theoretical pI: | 5.089 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 44.407 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.207 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342178.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| PFLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRD GSVLMSVSLDQLKAPELLYKSLATKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVITPLSEQLTKPLPNALALVTLKELSSGAHQLLPEGTRLAVSVRGDESHEELD ILKTTDATMILHHIPYSDDKT | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,894.849 | ||
| Theoretical pI: | 5.089 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 44.407 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.207 | ||
| sheet | 0.333 | ||