| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342182.1 | internal | 163 | 490-2(-) |
Amino Acid sequence : | |||
| HMKAFPNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKRKEAIPAS TGKVMLVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERIL | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 14,463.327 | ||
| Theoretical pI: | 11.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.411 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.403 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342182.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| RILSFPCAITANIIISNDKRAPENSSPSPSSLIIASTSITFPVLAGIASLRFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIA VPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,463.327 | ||
| Theoretical pI: | 11.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.411 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.403 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342182.1 | internal | 163 | 490-2(-) |
Amino Acid sequence : | |||
| HMKAFPNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKRKEAIPAS TGKVMLVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERIL | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 14,463.327 | ||
| Theoretical pI: | 11.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.411 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.403 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342182.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| RILSFPCAITANIIISNDKRAPENSSPSPSSLIIASTSITFPVLAGIASLRFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIA VPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,463.327 | ||
| Theoretical pI: | 11.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.411 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.403 | ||
| sheet | 0.209 | ||