| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342192.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| YSPPAPQPLPILPNFTDTNASVSFTNQFRSPAYKNHQINVPMNVTTNLLFTISVNIRACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVP QIFWTSSNGTRVRVLDYNATVELVFQETNIVAPSEHPMHLHGHNFYVVGSGFGNFNRARDAPNYNLVDPPFRNTIAVPRSGWTAIRFRANNPGVWLLHCHFERHITWGMEMAFITRNGRG PNATM | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 18,416.177 | ||
| Theoretical pI: | 8.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 57.435 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.170 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342192.1 | 3prime_partial | 159 | 479-3(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCLLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGGAAELVGEAHRRVGVGEIGEDWERLRGWRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,416.177 | ||
| Theoretical pI: | 8.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 57.435 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.170 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342192.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| YSPPAPQPLPILPNFTDTNASVSFTNQFRSPAYKNHQINVPMNVTTNLLFTISVNIRACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVP QIFWTSSNGTRVRVLDYNATVELVFQETNIVAPSEHPMHLHGHNFYVVGSGFGNFNRARDAPNYNLVDPPFRNTIAVPRSGWTAIRFRANNPGVWLLHCHFERHITWGMEMAFITRNGRG PNATM | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 18,416.177 | ||
| Theoretical pI: | 8.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 57.435 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.170 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342192.1 | 3prime_partial | 159 | 479-3(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCLLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGGAAELVGEAHRRVGVGEIGEDWERLRGWRGV | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,416.177 | ||
| Theoretical pI: | 8.991 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 57.435 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.170 | ||
| sheet | 0.226 | ||