Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342214.1 | complete | 150 | 54-506(+) |
Amino Acid sequence : | |||
MHAHCSQVIPSTYPTKVQFQQQHSGTSNILVTIFLKLPLAVVQRAHLTSLEPSANAMEVEGMVANTPSHCAFLACCAGLISLTLNAKIHDMIPANSTVIDHDVPGPEGYSVPLLDLKSFG FLRGRCRIGSGGTGAGGSLSRGNHIDVGVK* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 13,731.386 | ||
Theoretical pI: | 6.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34990 | ||
Instability index: | 42.973 | ||
aromaticity | 0.098 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.244 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342214.1 | complete | 123 | 512-141(-) |
Amino Acid sequence : | |||
MASLDTDVNMVPAGEGSSGAGPSGTNPTPSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWFKTRQVCPLDNSEWEFQK YGH* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,731.386 | ||
Theoretical pI: | 6.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34990 | ||
Instability index: | 42.973 | ||
aromaticity | 0.098 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.244 | ||
sheet | 0.211 |