| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342220.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| PSYDKFPHSGEILINLQPQTESDSISHIKLLIRRKTAAMAALDAGAYPEAIRHFSKILDGRRGAPQGFLSECYVHRASAFRSAGRIAEAIADCNRALALETSCIDALTIRAGLFETIRCL PDSLHDLEHLKLLYNSILRDRKLPGPVWKRQSVQYREIPGKLCSLDSKIKQLKERVAAGETGNVDYYALIGLRRGCSRSELERAHLLLTLKYKPDKSSSFIDKCEFADEKECDSVKDRAR MSSLLLYRLIQSGYTSVMP | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 11,859.371 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 106.714 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.388 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342220.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
| LLRQIPPFRRDFNQPSATNRVRQHLTHQTPHPPQNRRDGRPRRRRVPRSHPTFLQNPGWPPWSSAGVPLGVLRPSCLRLPLSRSNRGGNSRLQQSPGLGNFMH* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,859.371 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 106.714 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.388 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342220.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| PSYDKFPHSGEILINLQPQTESDSISHIKLLIRRKTAAMAALDAGAYPEAIRHFSKILDGRRGAPQGFLSECYVHRASAFRSAGRIAEAIADCNRALALETSCIDALTIRAGLFETIRCL PDSLHDLEHLKLLYNSILRDRKLPGPVWKRQSVQYREIPGKLCSLDSKIKQLKERVAAGETGNVDYYALIGLRRGCSRSELERAHLLLTLKYKPDKSSSFIDKCEFADEKECDSVKDRAR MSSLLLYRLIQSGYTSVMP | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 11,859.371 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 106.714 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.388 | ||
| sheet | 0.136 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342220.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
| LLRQIPPFRRDFNQPSATNRVRQHLTHQTPHPPQNRRDGRPRRRRVPRSHPTFLQNPGWPPWSSAGVPLGVLRPSCLRLPLSRSNRGGNSRLQQSPGLGNFMH* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,859.371 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 106.714 | ||
| aromaticity | 0.058 | ||
| GRAVY | -1.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.388 | ||
| sheet | 0.136 | ||