Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	internal	229	2-688(+)
Amino Acid sequence :
LLCLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLMHA AAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYLCRKKHGEI
Physicochemical properties
Number of amino acids:		229
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	3prime_partial	170	510-1(-)
Amino Acid sequence :
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAESVRWCMGSNTVSGDLIGMAFLRYELMSSWMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQRS
Physicochemical properties
Number of amino acids:		170
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	5prime_partial	150	1-453(+)
Amino Acid sequence :
TSLPPQFNQNGSKSLSQHQTKSPHQSDINLPPPTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHALRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHAC GGPRPRAPPPNRRLQARMQARYPTQVQPQH*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	internal	229	2-688(+)
Amino Acid sequence :
LLCLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLMHA AAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYLCRKKHGEI
Physicochemical properties
Number of amino acids:		229
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	3prime_partial	170	510-1(-)
Amino Acid sequence :
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAESVRWCMGSNTVSGDLIGMAFLRYELMSSWMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQRS
Physicochemical properties
Number of amino acids:		170
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342227.1	5prime_partial	150	1-453(+)
Amino Acid sequence :
TSLPPQFNQNGSKSLSQHQTKSPHQSDINLPPPTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHALRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHAC GGPRPRAPPPNRRLQARMQARYPTQVQPQH*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		17,048.203
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		91.123
aromaticity		0.013
GRAVY		-1.302
Secondary Structure Fraction
Helix		0.147
turn		0.327
sheet		0.180