| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342230.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
| TCFTYPLLLPPNMPAHNDYFGVPFRRVAIGNRNEFSQPGAVKAAVAEFISTLIFVFAGSGAGIAYNQLTGNAPTTPAGLIAASIAHAFGLFVAVAISANISGGHVNPAVTFGLFVGGNIT LFRGILYIIAQLLGSVAASALLTFTTGGCVRIKLLILSRITYN* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 10,842.402 | ||
| Theoretical pI: | 5.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 46.668 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.354 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342230.1 | 5prime_partial | 99 | 801-502(-) |
Amino Acid sequence : | |||
| GPVDPVVAEGKSHNSRPERHGWVHGGSGEGPGREDVGSHDQTNRNGCDDSDFALLRVDGGGVDGVHQPESRHDLEHQRGPHRYSRHAECWHSLCSNLHN* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,842.402 | ||
| Theoretical pI: | 5.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 46.668 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.354 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342230.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
| TCFTYPLLLPPNMPAHNDYFGVPFRRVAIGNRNEFSQPGAVKAAVAEFISTLIFVFAGSGAGIAYNQLTGNAPTTPAGLIAASIAHAFGLFVAVAISANISGGHVNPAVTFGLFVGGNIT LFRGILYIIAQLLGSVAASALLTFTTGGCVRIKLLILSRITYN* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 10,842.402 | ||
| Theoretical pI: | 5.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 46.668 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.354 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342230.1 | 5prime_partial | 99 | 801-502(-) |
Amino Acid sequence : | |||
| GPVDPVVAEGKSHNSRPERHGWVHGGSGEGPGREDVGSHDQTNRNGCDDSDFALLRVDGGGVDGVHQPESRHDLEHQRGPHRYSRHAECWHSLCSNLHN* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,842.402 | ||
| Theoretical pI: | 5.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 46.668 | ||
| aromaticity | 0.040 | ||
| GRAVY | -1.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.172 | ||
| turn | 0.354 | ||
| sheet | 0.152 | ||