| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342233.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| FFLISFFLLSSGYIVSEASAIGRHHRLRRREKLDRNLRPTKLFVFGDSYGDTGNVRKSLGSSWKEPYGATFPGKPAGRFSDGRILTDYIAKFLGLKSPLAYEWMKLGGEKVKRGLNFAYG GSGVFNTLGDILPNMSTQIGFFEKLMHDSVYSKRDLKSSVVLVCLAGNDYGAYLAQGGTMQGLQKFIPRVVKQLGANLERLRQLGANKVLVTSLEPLGCLPRTTVDSSYQKCNTTQNTAV SYHNLLLHQTLAQLNNNSKTSTFFIIDLYSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 11,670.050 | ||
| Theoretical pI: | 6.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.210 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342233.1 | complete | 105 | 443-126(-) |
Amino Acid sequence : | |||
| MHQFLEEADLSAHIRQYVAQRVEHAAPSVRKIQPPFHLFPSQFHPFIRQWRLEPQEFRNVIGEDAAVGEAAGRLAGEGGAVRLLPGAAERFSHVTGVAVGVSKYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,670.050 | ||
| Theoretical pI: | 6.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.210 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342233.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| FFLISFFLLSSGYIVSEASAIGRHHRLRRREKLDRNLRPTKLFVFGDSYGDTGNVRKSLGSSWKEPYGATFPGKPAGRFSDGRILTDYIAKFLGLKSPLAYEWMKLGGEKVKRGLNFAYG GSGVFNTLGDILPNMSTQIGFFEKLMHDSVYSKRDLKSSVVLVCLAGNDYGAYLAQGGTMQGLQKFIPRVVKQLGANLERLRQLGANKVLVTSLEPLGCLPRTTVDSSYQKCNTTQNTAV SYHNLLLHQTLAQLNNNSKTSTFFIIDLYSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 11,670.050 | ||
| Theoretical pI: | 6.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.210 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342233.1 | complete | 105 | 443-126(-) |
Amino Acid sequence : | |||
| MHQFLEEADLSAHIRQYVAQRVEHAAPSVRKIQPPFHLFPSQFHPFIRQWRLEPQEFRNVIGEDAAVGEAAGRLAGEGGAVRLLPGAAERFSHVTGVAVGVSKYE* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,670.050 | ||
| Theoretical pI: | 6.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.210 | ||
| sheet | 0.305 | ||