Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | internal | 178 | 535-2(-) |
Amino Acid sequence : | |||
VQRKSRPYSIPSRVPHATRPVIDNRGSSHHVHELRLIRWRHHHHVRKTGHISSVERAPMCGPICPHQSSSVHHEPHRELLEVHVVHHLIVPSLQEGGVDRAERLQPFCGETCGEGDGMLL GDPHVEATVGEALLEDVETGSAPHGRVDGDYFVVLLRFGDEGLGEVWGVGFCACFXLH | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | 3prime_partial | 178 | 2-535(+) |
Amino Acid sequence : | |||
MKXKTSTKSYTPYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTH WGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPRGNGVGAALPLN | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
DEXQNKHKILHPILRRVPRRRSGARRQSSRHPRGHGGRNRSQHLPEALPRPLLRRGDRRAACRHLRRRSRHRRAEAVLRDLLLLPAERVRSGGARRGPPEAPGEVHDGPSWIGGGRWAHT LGRVRHYLYGLSSEHGGDGAIG* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | internal | 178 | 535-2(-) |
Amino Acid sequence : | |||
VQRKSRPYSIPSRVPHATRPVIDNRGSSHHVHELRLIRWRHHHHVRKTGHISSVERAPMCGPICPHQSSSVHHEPHRELLEVHVVHHLIVPSLQEGGVDRAERLQPFCGETCGEGDGMLL GDPHVEATVGEALLEDVETGSAPHGRVDGDYFVVLLRFGDEGLGEVWGVGFCACFXLH | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | 3prime_partial | 178 | 2-535(+) |
Amino Acid sequence : | |||
MKXKTSTKSYTPYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTH WGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPRGNGVGAALPLN | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342241.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
DEXQNKHKILHPILRRVPRRRSGARRQSSRHPRGHGGRNRSQHLPEALPRPLLRRGDRRAACRHLRRRSRHRRAEAVLRDLLLLPAERVRSGGARRGPPEAPGEVHDGPSWIGGGRWAHT LGRVRHYLYGLSSEHGGDGAIG* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,982.934 | ||
Theoretical pI: | 11.974 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 112.278 | ||
aromaticity | 0.028 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.291 | ||
sheet | 0.234 |