| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
| PLAEFGEGNAGSPLKPFSTFQSLSAHVWQAVTRARELGPTDYTVFTVFADCRKRVEPPMPESYFGNLIQAIFTVTGAGLILGNPVEFGAGLIQSAIESHNAEAINKRNEEWESKPVIFQY KDAGVNCVAVGSSPRFQVYGVDFGWGSPESVRSGLNNRFDGMVYLYPGKSGGRSIDVEISLEPTTMEKLEKDKDFLMEACTYAYFTPLS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | 5prime_partial | 116 | 626-276(-) |
Amino Acid sequence : | |||
| ERGVKYAYVQASIKKSLSFSSFSIVVGSKLISTSMLLPPLFPGYKYTIPSNLLFNPLRTLSGLPHPKSTPYTWKRGELPTATQFTPASLYWNITGLLSHSSFLLLIASALCDSIAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | 5prime_partial | 111 | 627-292(-) |
Amino Acid sequence : | |||
| RERGKICICASLHQEVLVFLELLHSGRFQADLHINAPPTTLSRIQIHHPIEPVVQPAPHAFRAAPPEVHPVHLEAGRAPHRHAVHPGILVLEYHRLALPLLVPLIDRLRIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
| PLAEFGEGNAGSPLKPFSTFQSLSAHVWQAVTRARELGPTDYTVFTVFADCRKRVEPPMPESYFGNLIQAIFTVTGAGLILGNPVEFGAGLIQSAIESHNAEAINKRNEEWESKPVIFQY KDAGVNCVAVGSSPRFQVYGVDFGWGSPESVRSGLNNRFDGMVYLYPGKSGGRSIDVEISLEPTTMEKLEKDKDFLMEACTYAYFTPLS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | 5prime_partial | 116 | 626-276(-) |
Amino Acid sequence : | |||
| ERGVKYAYVQASIKKSLSFSSFSIVVGSKLISTSMLLPPLFPGYKYTIPSNLLFNPLRTLSGLPHPKSTPYTWKRGELPTATQFTPASLYWNITGLLSHSSFLLLIASALCDSIAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342243.1 | 5prime_partial | 111 | 627-292(-) |
Amino Acid sequence : | |||
| RERGKICICASLHQEVLVFLELLHSGRFQADLHINAPPTTLSRIQIHHPIEPVVQPAPHAFRAAPPEVHPVHLEAGRAPHRHAVHPGILVLEYHRLALPLLVPLIDRLRIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,481.538 | ||
| Theoretical pI: | 8.908 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 46.802 | ||
| aromaticity | 0.036 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.189 | ||
| sheet | 0.306 | ||