Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
PLAEFGEGNAGSPLKPFSTFQSLSAHVWQAVTRARELGPTDYTVFTVFADCRKRVEPPMPESYFGNLIQAIFTVTGAGLILGNPVEFGAGLIQSAIESHNAEAINKRNEEWESKPVIFQY KDAGVNCVAVGSSPRFQVYGVDFGWGSPESVRSGLNNRFDGMVYLYPGKSGGRSIDVEISLEPTTMEKLEKDKDFLMEACTYAYFTPLS | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | 5prime_partial | 116 | 626-276(-) |
Amino Acid sequence : | |||
ERGVKYAYVQASIKKSLSFSSFSIVVGSKLISTSMLLPPLFPGYKYTIPSNLLFNPLRTLSGLPHPKSTPYTWKRGELPTATQFTPASLYWNITGLLSHSSFLLLIASALCDSIAL* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | 5prime_partial | 111 | 627-292(-) |
Amino Acid sequence : | |||
RERGKICICASLHQEVLVFLELLHSGRFQADLHINAPPTTLSRIQIHHPIEPVVQPAPHAFRAAPPEVHPVHLEAGRAPHRHAVHPGILVLEYHRLALPLLVPLIDRLRIV* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | internal | 209 | 1-627(+) |
Amino Acid sequence : | |||
PLAEFGEGNAGSPLKPFSTFQSLSAHVWQAVTRARELGPTDYTVFTVFADCRKRVEPPMPESYFGNLIQAIFTVTGAGLILGNPVEFGAGLIQSAIESHNAEAINKRNEEWESKPVIFQY KDAGVNCVAVGSSPRFQVYGVDFGWGSPESVRSGLNNRFDGMVYLYPGKSGGRSIDVEISLEPTTMEKLEKDKDFLMEACTYAYFTPLS | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | 5prime_partial | 116 | 626-276(-) |
Amino Acid sequence : | |||
ERGVKYAYVQASIKKSLSFSSFSIVVGSKLISTSMLLPPLFPGYKYTIPSNLLFNPLRTLSGLPHPKSTPYTWKRGELPTATQFTPASLYWNITGLLSHSSFLLLIASALCDSIAL* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342243.1 | 5prime_partial | 111 | 627-292(-) |
Amino Acid sequence : | |||
RERGKICICASLHQEVLVFLELLHSGRFQADLHINAPPTTLSRIQIHHPIEPVVQPAPHAFRAAPPEVHPVHLEAGRAPHRHAVHPGILVLEYHRLALPLLVPLIDRLRIV* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,481.538 | ||
Theoretical pI: | 8.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 46.802 | ||
aromaticity | 0.036 | ||
GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.189 | ||
sheet | 0.306 |