| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342247.1 | internal | 257 | 771-1(-) |
Amino Acid sequence : | |||
| QNSPVLLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDM FKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHPRLCLSCYQ NYVCDNGIIPNYFCLWD | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 15,292.210 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 51.997 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.255 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342247.1 | 3prime_partial | 137 | 361-771(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQHRAVL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,292.210 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 51.997 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.255 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342247.1 | internal | 257 | 771-1(-) |
Amino Acid sequence : | |||
| QNSPVLLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDM FKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYTVKDIDSIISIIEAHPRLCLSCYQ NYVCDNGIIPNYFCLWD | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 15,292.210 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 51.997 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.255 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342247.1 | 3prime_partial | 137 | 361-771(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQHRAVL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,292.210 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 51.997 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.255 | ||
| sheet | 0.270 | ||