Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342248.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
EPFHERGSPETLRDPIGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKF HWKPTCGVKSLLEDDAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDYEDRYDFDPVDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYSDDKLLQTR IFSYSDTQRHR | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 15,980.644 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 50.922 | ||
aromaticity | 0.042 | ||
GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.245 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342248.1 | 5prime_partial | 143 | 755-324(-) |
Amino Acid sequence : | |||
TVPLSIRVRKDSSLEQLVIRIVNPRNNKSRAKCKLFILRKEVVNVLVQHQTTNGLQGDDVLGPSLCNINWVEVISVFVIRIYGLNKEFPLRIIACCNRVIEILGSMAVISSSNLDSIVLQ QTLHTTGGLPVELHIIRFPSLVD* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,980.644 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 50.922 | ||
aromaticity | 0.042 | ||
GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.245 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342248.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
EPFHERGSPETLRDPIGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKF HWKPTCGVKSLLEDDAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDYEDRYDFDPVDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYSDDKLLQTR IFSYSDTQRHR | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 15,980.644 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 50.922 | ||
aromaticity | 0.042 | ||
GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.245 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342248.1 | 5prime_partial | 143 | 755-324(-) |
Amino Acid sequence : | |||
TVPLSIRVRKDSSLEQLVIRIVNPRNNKSRAKCKLFILRKEVVNVLVQHQTTNGLQGDDVLGPSLCNINWVEVISVFVIRIYGLNKEFPLRIIACCNRVIEILGSMAVISSSNLDSIVLQ QTLHTTGGLPVELHIIRFPSLVD* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,980.644 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 50.922 | ||
aromaticity | 0.042 | ||
GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.245 | ||
sheet | 0.196 |