Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342261.1 | complete | 142 | 47-475(+) |
Amino Acid sequence : | |||
MIKPDGVQRNLVGEIIGRFEKKGFTLKGLKLLTVDREFAKKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKNVVTTGRKIIGATNPAESAPGTIRGDYAIDIGRNVIHGSDAVESARKE IALWFPEGIAEWRSSCHDWIYE* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,732.874 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 24.590 | ||
aromaticity | 0.099 | ||
GRAVY | -0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.232 | ||
sheet | 0.232 |