| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342265.1 | 3prime_partial | 185 | 121-675(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVT NYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLP | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 14,302.010 | ||
| Theoretical pI: | 11.455 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 70.935 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.793 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342265.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,302.010 | ||
| Theoretical pI: | 11.455 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 70.935 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.793 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342265.1 | 3prime_partial | 185 | 121-675(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVT NYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLP | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 14,302.010 | ||
| Theoretical pI: | 11.455 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 70.935 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.793 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342265.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,302.010 | ||
| Theoretical pI: | 11.455 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 70.935 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.793 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||