| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342266.1 | internal | 265 | 795-1(-) |
Amino Acid sequence : | |||
| RFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGARHGM AIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVAFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPSSTGKVMIVDAIINEEGEGDEYSGAGLSLDMTMMAMPPQGKERSY KEWVHLLNEAGFSKRLSQNHHNYTN | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 29,161.110 | ||
| Theoretical pI: | 6.483 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
| Instability index: | 29.550 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.249 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342266.1 | internal | 265 | 795-1(-) |
Amino Acid sequence : | |||
| RFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGARHGM AIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVAFVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPSSTGKVMIVDAIINEEGEGDEYSGAGLSLDMTMMAMPPQGKERSY KEWVHLLNEAGFSKRLSQNHHNYTN | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 29,161.110 | ||
| Theoretical pI: | 6.483 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
| Instability index: | 29.550 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.249 | ||
| sheet | 0.283 | ||