Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342279.1 | complete | 216 | 32-682(+) |
Amino Acid sequence : | |||
MSKLSGDATREAISQIVSECKEKKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIGMESMDVEALKKLNKNKKLVKKLAKKYHAFLASEAVIKQIP RLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLDMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGKPQRIF* | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 12,868.645 | ||
Theoretical pI: | 5.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 44.273 | ||
aromaticity | 0.053 | ||
GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.177 | ||
sheet | 0.363 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342279.1 | complete | 113 | 700-359(-) |
Amino Acid sequence : | |||
MHMITILEDALWLAHGTLQVQAPHVLPVLFQERNEEIHAHLNVLEDLLLFHVQVPNSDAHAEHLFQLELDCSLRLIHLGLERFLVGHKSRELPCFVKTGSQETGNLLDNSLRG* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,868.645 | ||
Theoretical pI: | 5.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 44.273 | ||
aromaticity | 0.053 | ||
GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.177 | ||
sheet | 0.363 |