| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342286.1 | 5prime_partial | 218 | 1-657(+) |
Amino Acid sequence : | |||
| ICRAMASRGLLVILALTSALLLPEARANSEGDALYALRRSLTDPDNVLQSWDPNLVNPCTWFHITCNQDNSVTRVDLGNSNLSGHLVPELGKLESLQYLELYKNNIQGGIPAELGNLKSL ITLDLYNNNITGTIPPSLGNLKSLVFLRLNDNHLHGSIPRTLSGISTLKVIDVSNNDLCGTIPSSGPFERIPLNNFENSPRLEGPELQGLASYDTNCS* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,703.589 | ||
| Theoretical pI: | 5.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 36.451 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.339 | ||
| sheet | 0.271 | ||