| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342300.1 | internal | 275 | 3-827(+) |
Amino Acid sequence : | |||
| FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 30,730.916 | ||
| Theoretical pI: | 7.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 27.025 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.182 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342300.1 | internal | 275 | 3-827(+) |
Amino Acid sequence : | |||
| FSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 30,730.916 | ||
| Theoretical pI: | 7.055 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 27.025 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.182 | ||
| sheet | 0.225 | ||