| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342309.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| VKNQVAENLIPDFDFDRLISTRLMKPTGNADATVVVMVVDAVDFEGSFPKRAAKSLFKALSTGQDGKQSKKLPKLVLVATKVDLLPSQISPARLDRWVRHRARANGAPKLSAVYLVSSRK DLGVRNLLAFIKDLAGPRGNVWVIGAQNAGKSTLINAFAKKEGVKVAKLTEAPIPGTTLGILRIGGILPAKAKLYDTPGLLHPYLMSMRLNRDEQKMVEIRKELQPRSFRIKAGQTVHVG GLVRLDLDRASVDTIYVTVWASPSVSL | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 14,986.114 | ||
| Theoretical pI: | 10.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 67.863 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342309.1 | complete | 128 | 716-330(-) |
Amino Acid sequence : | |||
| MYSLTSLYPKRSGLKLFSYLNHLLLVPVQSHGHQVWVQKSRRIIQLCLSRQNPSNPEYPKRCSRNRSFCQLSNLYPFFLGKCVDQRRFPSILSSNNPNIPSRPSQILDECKQVPHTQIFP RTNQVDRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,986.114 | ||
| Theoretical pI: | 10.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 67.863 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342309.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| VKNQVAENLIPDFDFDRLISTRLMKPTGNADATVVVMVVDAVDFEGSFPKRAAKSLFKALSTGQDGKQSKKLPKLVLVATKVDLLPSQISPARLDRWVRHRARANGAPKLSAVYLVSSRK DLGVRNLLAFIKDLAGPRGNVWVIGAQNAGKSTLINAFAKKEGVKVAKLTEAPIPGTTLGILRIGGILPAKAKLYDTPGLLHPYLMSMRLNRDEQKMVEIRKELQPRSFRIKAGQTVHVG GLVRLDLDRASVDTIYVTVWASPSVSL | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 14,986.114 | ||
| Theoretical pI: | 10.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 67.863 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.141 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342309.1 | complete | 128 | 716-330(-) |
Amino Acid sequence : | |||
| MYSLTSLYPKRSGLKLFSYLNHLLLVPVQSHGHQVWVQKSRRIIQLCLSRQNPSNPEYPKRCSRNRSFCQLSNLYPFFLGKCVDQRRFPSILSSNNPNIPSRPSQILDECKQVPHTQIFP RTNQVDRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,986.114 | ||
| Theoretical pI: | 10.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 67.863 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.313 | ||
| sheet | 0.141 | ||