| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342312.1 | 3prime_partial | 165 | 58-552(+) |
Amino Acid sequence : | |||
| MGGLTTISNGVENLIQRGYKTLSPFCSPHTITNMGSALLAIHTGFMGPNYSISTACATSNHCFFAAANHIRRGDADLMLAGGTEATLSPIGLGSFIACKSLSHRNHDPEKASRPWDRNRD GFVMGEGAGVLIMESLAHPRKRGAEIYAQFLGGAVNCDAHHMTAP | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 13,495.759 | ||
| Theoretical pI: | 6.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.107 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.349 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342312.1 | 5prime_partial | 129 | 552-163(-) |
Amino Acid sequence : | |||
| RSRHVMSVTINRPSQKLCINLRPSFPGVRQALHYQNTCTFSHDKTVAIPIPWPGRLLRVVVSVGEGFAGYETSESDGREGSFGSSGEHEVSVAASDVVSGGEEAVVGGGAGSRNGVIGAH EAGVYGEQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,495.759 | ||
| Theoretical pI: | 6.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.107 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.349 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342312.1 | 3prime_partial | 165 | 58-552(+) |
Amino Acid sequence : | |||
| MGGLTTISNGVENLIQRGYKTLSPFCSPHTITNMGSALLAIHTGFMGPNYSISTACATSNHCFFAAANHIRRGDADLMLAGGTEATLSPIGLGSFIACKSLSHRNHDPEKASRPWDRNRD GFVMGEGAGVLIMESLAHPRKRGAEIYAQFLGGAVNCDAHHMTAP | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 13,495.759 | ||
| Theoretical pI: | 6.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.107 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.349 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342312.1 | 5prime_partial | 129 | 552-163(-) |
Amino Acid sequence : | |||
| RSRHVMSVTINRPSQKLCINLRPSFPGVRQALHYQNTCTFSHDKTVAIPIPWPGRLLRVVVSVGEGFAGYETSESDGREGSFGSSGEHEVSVAASDVVSGGEEAVVGGGAGSRNGVIGAH EAGVYGEQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,495.759 | ||
| Theoretical pI: | 6.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.107 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.349 | ||
| sheet | 0.194 | ||