| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342325.1 | 3prime_partial | 256 | 65-832(+) |
Amino Acid sequence : | |||
| MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELGRNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQKRLMVLRASVALHGRS VTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAGFKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKSNPISCQILLYKSRSKGRK NQRSTRTHCHHPSPKI | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,447.907 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45420 | ||
| Instability index: | 43.171 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.426 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.219 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342325.1 | 3prime_partial | 256 | 65-832(+) |
Amino Acid sequence : | |||
| MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELGRNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQKRLMVLRASVALHGRS VTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAGFKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKSNPISCQILLYKSRSKGRK NQRSTRTHCHHPSPKI | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,447.907 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45420 | ||
| Instability index: | 43.171 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.426 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.219 | ||
| sheet | 0.246 | ||