Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342332.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
ENLINQLPSRLTENVAVKQVDILQNMEESIGKYFNFNLSKEQKKFLVDKGVYLSPFSWKHHSHPGCKTIENWLLYNEIGFHIRHICRDSSVAFLSLREGKLKNLEKIHFRQGNHDQTNDK IRSFNKIHSPKDCLRYSSFSDRETLYQSFRDIGMKMEKRSCYFIHDECHYWNPADLDRFIRYTDAESIMFTVIHPVEVDVGKTSSHLPFLYEFCIDGETLHFFPDGNKSEGYEQPLSAXW WLKMSRFIS | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 29,385.993 | ||
Theoretical pI: | 6.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42775 | ||
Instability index: | 52.068 | ||
aromaticity | 0.133 | ||
GRAVY | -0.584 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.230 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342332.1 | internal | 249 | 1-747(+) |
Amino Acid sequence : | |||
ENLINQLPSRLTENVAVKQVDILQNMEESIGKYFNFNLSKEQKKFLVDKGVYLSPFSWKHHSHPGCKTIENWLLYNEIGFHIRHICRDSSVAFLSLREGKLKNLEKIHFRQGNHDQTNDK IRSFNKIHSPKDCLRYSSFSDRETLYQSFRDIGMKMEKRSCYFIHDECHYWNPADLDRFIRYTDAESIMFTVIHPVEVDVGKTSSHLPFLYEFCIDGETLHFFPDGNKSEGYEQPLSAXW WLKMSRFIS | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 29,385.993 | ||
Theoretical pI: | 6.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42775 | ||
Instability index: | 52.068 | ||
aromaticity | 0.133 | ||
GRAVY | -0.584 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.230 | ||
sheet | 0.198 |