| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342339.1 | 3prime_partial | 182 | 78-623(+) |
Amino Acid sequence : | |||
| MASTFAGLSSVGSLAAPGSRVLDDKVAVSSGKLSSLASISSSSLGRRKNVALRKTRPAQITAASKDLYFNKDGSAFKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA REVELEDPVENIGAKLVRQPAAKTNDLAGDGTTTSVVLAQGLIAERVKVVPAGANPVLITRG | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 12,720.828 | ||
| Theoretical pI: | 10.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.931 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342339.1 | 5prime_partial | 123 | 622-251(-) |
Amino Acid sequence : | |||
| PLVIRTGFAPAGTTLTRSAMRPCARTTDVVVPSPAKSLVLAAGCLTNLAPMFSTGSSNSTSLATVTPSLTIFGAPYLLSRTTFLPLGPRVTPTRSASLLTPTCSLLKAEPSLLKYKSLEA AVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,720.828 | ||
| Theoretical pI: | 10.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.931 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342339.1 | 3prime_partial | 182 | 78-623(+) |
Amino Acid sequence : | |||
| MASTFAGLSSVGSLAAPGSRVLDDKVAVSSGKLSSLASISSSSLGRRKNVALRKTRPAQITAASKDLYFNKDGSAFKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA REVELEDPVENIGAKLVRQPAAKTNDLAGDGTTTSVVLAQGLIAERVKVVPAGANPVLITRG | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 12,720.828 | ||
| Theoretical pI: | 10.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.931 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342339.1 | 5prime_partial | 123 | 622-251(-) |
Amino Acid sequence : | |||
| PLVIRTGFAPAGTTLTRSAMRPCARTTDVVVPSPAKSLVLAAGCLTNLAPMFSTGSSNSTSLATVTPSLTIFGAPYLLSRTTFLPLGPRVTPTRSASLLTPTCSLLKAEPSLLKYKSLEA AVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,720.828 | ||
| Theoretical pI: | 10.306 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 35.931 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.423 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.293 | ||
| sheet | 0.301 | ||