| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342360.1 | 3prime_partial | 179 | 268-804(+) |
Amino Acid sequence : | |||
| MNGSKKKEKELSTWEADLNRRERELKRREDAVASAGVPVDDRNWPPFFPIIHHDIPNEIPVRAQKLQYLAFASWLGIVLCLTFNVIAITVCWIKGGGVKIFFLAIIYALMGCPLSYVLWY RPLYRAMRTDSALKFGWFFMFYMLHIGFCIVAAIAPPIVFHGKSLTGILAAVDVFSDHA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,379.830 | ||
| Theoretical pI: | 9.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42190 | ||
| Instability index: | 36.858 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.190 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342360.1 | 3prime_partial | 179 | 268-804(+) |
Amino Acid sequence : | |||
| MNGSKKKEKELSTWEADLNRRERELKRREDAVASAGVPVDDRNWPPFFPIIHHDIPNEIPVRAQKLQYLAFASWLGIVLCLTFNVIAITVCWIKGGGVKIFFLAIIYALMGCPLSYVLWY RPLYRAMRTDSALKFGWFFMFYMLHIGFCIVAAIAPPIVFHGKSLTGILAAVDVFSDHA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,379.830 | ||
| Theoretical pI: | 9.097 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42190 | ||
| Instability index: | 36.858 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.330 | ||
Secondary Structure Fraction | |||
| Helix | 0.397 | ||
| turn | 0.190 | ||
| sheet | 0.263 | ||