| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342364.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| LSRIRHEDLFEEPNNTHMASTTLRRLEGKVALITGAARGIGEAAARLFSRHGAKVIIADVQDDVARSICKDVGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGVIEPPQFKLLS DFPLPEFNRIVGVNLAGVFLGTKHAARVMIPRRRGSIISTASVAGVMGGVSGHAYAASKHGVVGLMKNAAVELGRHGVRVNCVSPYAVASTPMSRKFLEGGDAGLKDFFHTLKGLELTA | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 15,275.843 | ||
| Theoretical pI: | 7.446 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 72.621 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342364.1 | 5prime_partial | 138 | 718-302(-) |
Amino Acid sequence : | |||
| RRQLQSFQGMKEILQPRIAALQEFPGHRSTSHGVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVAADAAHHAGDARRRDDAPPPPGDHHPGGVFRPQKHAGEIHADDAVEFRQREVG EQLELRRLDDAGVIVHDV* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,275.843 | ||
| Theoretical pI: | 7.446 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 72.621 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342364.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
| LSRIRHEDLFEEPNNTHMASTTLRRLEGKVALITGAARGIGEAAARLFSRHGAKVIIADVQDDVARSICKDVGSTFVHCDVTKESDVEAAVNAAVKTHGTLDIMYNNAGVIEPPQFKLLS DFPLPEFNRIVGVNLAGVFLGTKHAARVMIPRRRGSIISTASVAGVMGGVSGHAYAASKHGVVGLMKNAAVELGRHGVRVNCVSPYAVASTPMSRKFLEGGDAGLKDFFHTLKGLELTA | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 15,275.843 | ||
| Theoretical pI: | 7.446 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 72.621 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342364.1 | 5prime_partial | 138 | 718-302(-) |
Amino Acid sequence : | |||
| RRQLQSFQGMKEILQPRIAALQEFPGHRSTSHGVRRDAVHADAVPPQLHGGVLHQPHHAVLRRGVRVAADAAHHAGDARRRDDAPPPPGDHHPGGVFRPQKHAGEIHADDAVEFRQREVG EQLELRRLDDAGVIVHDV* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,275.843 | ||
| Theoretical pI: | 7.446 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 72.621 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.196 | ||
| sheet | 0.246 | ||