Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342377.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
YDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESS LSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAWSCRWKKHLG* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,741.604 | ||
Theoretical pI: | 5.810 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 29.734 | ||
aromaticity | 0.128 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.213 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342377.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
YDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESS LSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAWSCRWKKHLG* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,741.604 | ||
Theoretical pI: | 5.810 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 29.734 | ||
aromaticity | 0.128 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.213 | ||
sheet | 0.282 |