| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342377.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| YDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESS LSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAWSCRWKKHLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,741.604 | ||
| Theoretical pI: | 5.810 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 29.734 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.213 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342377.1 | 5prime_partial | 188 | 2-568(+) |
Amino Acid sequence : | |||
| YDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESS LSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAWSCRWKKHLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,741.604 | ||
| Theoretical pI: | 5.810 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 29.734 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.213 | ||
| sheet | 0.282 | ||