| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342379.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| ARRYVPNSARGGKVITCKAAVAYGAGQPLVVEEIRVDPPQQMEVRIRVLFTSICHTDLSAWLGEAEAQRAYPRILGHEASGYCKSKKTNLCEKFRVNPMKSTMVNDGKCRFSTKDGQPIF HFLNTSTFSEYTVIDSACVVKIDREAPLKKMTLLSCGVSTGLGAVWNTADLEERPTVAVFGLGAVGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,066.918 | ||
| Theoretical pI: | 11.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 58.169 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.236 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342379.1 | 5prime_partial | 106 | 563-243(-) |
Amino Acid sequence : | |||
| ANPTAPRPKTATVGRSSRSAVFHTAPRPVETPQLRRVIFFRGASRSILTTQAESITVYSLKVEVLRKWKMGCPSFVENRHFPSFTIVLFMGFTRNFSHKLVFLDLQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,066.918 | ||
| Theoretical pI: | 11.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 58.169 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.236 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342379.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| ARRYVPNSARGGKVITCKAAVAYGAGQPLVVEEIRVDPPQQMEVRIRVLFTSICHTDLSAWLGEAEAQRAYPRILGHEASGYCKSKKTNLCEKFRVNPMKSTMVNDGKCRFSTKDGQPIF HFLNTSTFSEYTVIDSACVVKIDREAPLKKMTLLSCGVSTGLGAVWNTADLEERPTVAVFGLGAVGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,066.918 | ||
| Theoretical pI: | 11.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 58.169 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.236 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342379.1 | 5prime_partial | 106 | 563-243(-) |
Amino Acid sequence : | |||
| ANPTAPRPKTATVGRSSRSAVFHTAPRPVETPQLRRVIFFRGASRSILTTQAESITVYSLKVEVLRKWKMGCPSFVENRHFPSFTIVLFMGFTRNFSHKLVFLDLQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,066.918 | ||
| Theoretical pI: | 11.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 58.169 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.236 | ||
| sheet | 0.198 | ||