| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342381.1 | internal | 213 | 1-639(+) |
Amino Acid sequence : | |||
| GKVITSLAAVAYGAGQPLVVEEIRVDPPQQMEVRIRVLFTSICHTDLSAWLGEAEAQRAYPRILGHEASGYCKSKKTNLCEKFRVNPMKSTMVNDGKCRFSTKDGQPIFHFLNTSTFSEY TVIDSACVVKIDREAPLKKMTLLSCGVSTGLGAVWNTADVEEGSTVAVFGLGAVGLAVVQGARTRGASRIIGVDINSDKKFKGQAIGITDFIN | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 13,849.037 | ||
| Theoretical pI: | 10.279 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.786 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.234 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342381.1 | complete | 124 | 584-210(-) |
Amino Acid sequence : | |||
| MSTPIILDAPLVLAPCTTANPTAPRPKTATVDPSSTSAVFHTAPRPVETPQLRRVIFFRGASRSILTTQAESITVYSLKVEVLRKWKMGCPSFVENRHFPSFTIVLFMGFTRNFSHKLVF LDLQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,849.037 | ||
| Theoretical pI: | 10.279 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.786 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.234 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342381.1 | internal | 213 | 1-639(+) |
Amino Acid sequence : | |||
| GKVITSLAAVAYGAGQPLVVEEIRVDPPQQMEVRIRVLFTSICHTDLSAWLGEAEAQRAYPRILGHEASGYCKSKKTNLCEKFRVNPMKSTMVNDGKCRFSTKDGQPIFHFLNTSTFSEY TVIDSACVVKIDREAPLKKMTLLSCGVSTGLGAVWNTADVEEGSTVAVFGLGAVGLAVVQGARTRGASRIIGVDINSDKKFKGQAIGITDFIN | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 13,849.037 | ||
| Theoretical pI: | 10.279 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.786 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.234 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342381.1 | complete | 124 | 584-210(-) |
Amino Acid sequence : | |||
| MSTPIILDAPLVLAPCTTANPTAPRPKTATVDPSSTSAVFHTAPRPVETPQLRRVIFFRGASRSILTTQAESITVYSLKVEVLRKWKMGCPSFVENRHFPSFTIVLFMGFTRNFSHKLVF LDLQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,849.037 | ||
| Theoretical pI: | 10.279 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.786 | ||
| aromaticity | 0.097 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.234 | ||
| sheet | 0.218 | ||