Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342387.1 | complete | 132 | 77-475(+) |
Amino Acid sequence : | |||
MAKVFTLAEVSEHSTNKDCWLIIGGKVYDMTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSENAKSMMEEWCIGEIDVSTIPSKKKYTPPKQPHYNQDKTSEFIIKLLQFLVPLIILGV AVGLRFYSKSEA* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,756.653 | ||
Theoretical pI: | 4.993 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 39.808 | ||
aromaticity | 0.091 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.220 | ||
sheet | 0.235 |