| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342390.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| EMATTNSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGYGAKVVLSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAGLPEGGVVLLE NVRFYKEEEKNDPEFAKKLASLGDLYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFY | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 17,790.135 | ||
| Theoretical pI: | 9.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 49.992 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.253 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342390.1 | 5prime_partial | 154 | 698-234(-) |
Amino Acid sequence : | |||
| VEGKDHSSTEQKHIHLLQKGLYDTDFRGYLGATNNGSKWFLGVGYSPNQIIKFLLHEESSNCRLQVLCYPLGRSMSSVRRSKSIIYIQVSQGCKLFRKLRIVLLLLLVESNILQENNATF RQASHQLLNFFTNTITRHFDLNSQKFGESRNERL* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,790.135 | ||
| Theoretical pI: | 9.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 49.992 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.253 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342390.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| EMATTNSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGYGAKVVLSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAGLPEGGVVLLE NVRFYKEEEKNDPEFAKKLASLGDLYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDVLLLGGGMIFTFY | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 17,790.135 | ||
| Theoretical pI: | 9.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 49.992 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.253 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342390.1 | 5prime_partial | 154 | 698-234(-) |
Amino Acid sequence : | |||
| VEGKDHSSTEQKHIHLLQKGLYDTDFRGYLGATNNGSKWFLGVGYSPNQIIKFLLHEESSNCRLQVLCYPLGRSMSSVRRSKSIIYIQVSQGCKLFRKLRIVLLLLLVESNILQENNATF RQASHQLLNFFTNTITRHFDLNSQKFGESRNERL* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,790.135 | ||
| Theoretical pI: | 9.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 49.992 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.253 | ||
| sheet | 0.221 | ||