| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342394.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| LLQPSTIPNMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFQVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESNEFVG EKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAEVASSTRIIYGGSVNGGNCKELAGQTDVDGFL VG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 14,343.364 | ||
| Theoretical pI: | 10.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 69.039 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.362 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342394.1 | 5prime_partial | 127 | 727-344(-) |
Amino Acid sequence : | |||
| TNKKTIDISLSSQFLAVAAIHRSSINNPGRRSNFSVNICLKPFPQLKMYFLSLGRSGNLSSSNSPHRFISQHNICPIRNTFCYGLSLCSHNIYSSSGFSLFKRLTNTGNHLQTLRKRICN FFSNKLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,343.364 | ||
| Theoretical pI: | 10.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 69.039 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.362 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342394.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
| LLQPSTIPNMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFQVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESNEFVG EKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAEVASSTRIIYGGSVNGGNCKELAGQTDVDGFL VG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 14,343.364 | ||
| Theoretical pI: | 10.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 69.039 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.362 | ||
| sheet | 0.142 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342394.1 | 5prime_partial | 127 | 727-344(-) |
Amino Acid sequence : | |||
| TNKKTIDISLSSQFLAVAAIHRSSINNPGRRSNFSVNICLKPFPQLKMYFLSLGRSGNLSSSNSPHRFISQHNICPIRNTFCYGLSLCSHNIYSSSGFSLFKRLTNTGNHLQTLRKRICN FFSNKLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,343.364 | ||
| Theoretical pI: | 10.778 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 69.039 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.362 | ||
| sheet | 0.142 | ||