| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342399.1 | 3prime_partial | 107 | 323-3(-) |
Amino Acid sequence : | |||
| MRTAALEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYASEVAVYVEPGRIRKLTGVKAKEILLWVSVTDINLA | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,133.113 | ||
| Theoretical pI: | 6.732 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 26.278 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.150 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342399.1 | 3prime_partial | 107 | 323-3(-) |
Amino Acid sequence : | |||
| MRTAALEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYASEVAVYVEPGRIRKLTGVKAKEILLWVSVTDINLA | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,133.113 | ||
| Theoretical pI: | 6.732 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 26.278 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.150 | ||
| sheet | 0.299 | ||