Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	203	1-612(+)
Amino Acid sequence :
LKFISPLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSV LDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPAG*
Physicochemical properties
Number of amino acids:		203
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	157	633-160(-)
Amino Acid sequence :
QVKVLVGSSCGVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGA VELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	129	2-391(+)
Amino Acid sequence :
SNSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPS WTATICRWR*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	203	1-612(+)
Amino Acid sequence :
LKFISPLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSV LDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPAG*
Physicochemical properties
Number of amino acids:		203
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	157	633-160(-)
Amino Acid sequence :
QVKVLVGSSCGVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEGGA VELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342400.1	5prime_partial	129	2-391(+)
Amino Acid sequence :
SNSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPS WTATICRWR*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		12,713.819
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.692
Secondary Structure Fraction
Helix		0.070
turn		0.473
sheet		0.209