| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342406.1 | complete | 148 | 3-449(+) |
Amino Acid sequence : | |||
| MALLVPLNSSGREYKVKDMSHADFSRLEINLPEVKMPGLMSSRTEFSPSHPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVISRDSATVFAWKGETLQEYWWC TKRTLDWGPGGGPDLIFNDGGDATLMIH* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,315.477 | ||
| Theoretical pI: | 5.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 56.370 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.243 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342406.1 | complete | 148 | 3-449(+) |
Amino Acid sequence : | |||
| MALLVPLNSSGREYKVKDMSHADFSRLEINLPEVKMPGLMSSRTEFSPSHPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVISRDSATVFAWKGETLQEYWWC TKRTLDWGPGGGPDLIFNDGGDATLMIH* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,315.477 | ||
| Theoretical pI: | 5.911 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 56.370 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.243 | ||
| sheet | 0.270 | ||