| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342412.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| VVDCTAEGVVFTGAYADATMEQFGDILRPPFPNLEELIYDVPGTREVINCPLLLCQVTRLKCDGFIFAFRFNHTMCDAAGLLQFLSAVGELARGADAPSAPPVWDRHLLTARCPPCVPFT HREYALKPDTAAAIAGNLVERSFLFDAADIAALRRMLPPHCRGCTKFELVMACVWRCRTVALSPNPNEEVQFSVLVNLRKRLNRPIPKGYYGNLMVFPTAVAVAEKLMKNSLDYAVDLVR KMKSDATEEYME | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,035.343 | ||
| Theoretical pI: | 6.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 22055 | ||
| Instability index: | 43.762 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.190 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342412.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| VVDCTAEGVVFTGAYADATMEQFGDILRPPFPNLEELIYDVPGTREVINCPLLLCQVTRLKCDGFIFAFRFNHTMCDAAGLLQFLSAVGELARGADAPSAPPVWDRHLLTARCPPCVPFT HREYALKPDTAAAIAGNLVERSFLFDAADIAALRRMLPPHCRGCTKFELVMACVWRCRTVALSPNPNEEVQFSVLVNLRKRLNRPIPKGYYGNLMVFPTAVAVAEKLMKNSLDYAVDLVR KMKSDATEEYME | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,035.343 | ||
| Theoretical pI: | 6.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 22055 | ||
| Instability index: | 43.762 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.190 | ||
| sheet | 0.313 | ||