Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | 5prime_partial | 261 | 1-786(+) |
Amino Acid sequence : | |||
RLMSSSKSRRRNPPPSMAQEQLVLRGTMRAHTDWVTAIATPIDNSDMIVTASRDKSIILWSLTKEDRTYGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVG HTKDVLSVAFSVDNRQIVSASRDKSIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKIWNLTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLA EGKKLYSLDAGSIIHPPLLQP* | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | complete | 149 | 495-46(-) |
Amino Acid sequence : | |||
MGVLVLNGVLALAEGVPELNRLVAGSGDDLAVIDGEGDGEDVLGVADEAAGGGAGLEVPEAELAIPGTGEGELAVGGEDDVLDEVRVAGEAAAGDAVGAVLLGEGPEDDGLVAGSGDDHV GVVDRGGDGGDPVGVGTHGAAEDELLLRH* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | 5prime_partial | 132 | 3-401(+) |
Amino Acid sequence : | |||
LNVLLQIPSPQSTTFNGAGAARPPRHHACPHRLGHRHRHPDRQLRHDRHRFPRQVHHPLVPHQGGPHLRRRPPPPHRPLSLRPGRRPLLRRPVRPLRFLGWRAPPLGPPGRHHRPPLRRP HQGRPLRRLLRR* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | 5prime_partial | 261 | 1-786(+) |
Amino Acid sequence : | |||
RLMSSSKSRRRNPPPSMAQEQLVLRGTMRAHTDWVTAIATPIDNSDMIVTASRDKSIILWSLTKEDRTYGVARRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLQAGTTARRFVG HTKDVLSVAFSVDNRQIVSASRDKSIKLWNTLGECKYTIQDQDAHSDWVSCVRFSPNTLQPTIVSGSWDKTVKIWNLTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLA EGKKLYSLDAGSIIHPPLLQP* | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | complete | 149 | 495-46(-) |
Amino Acid sequence : | |||
MGVLVLNGVLALAEGVPELNRLVAGSGDDLAVIDGEGDGEDVLGVADEAAGGGAGLEVPEAELAIPGTGEGELAVGGEDDVLDEVRVAGEAAAGDAVGAVLLGEGPEDDGLVAGSGDDHV GVVDRGGDGGDPVGVGTHGAAEDELLLRH* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342417.1 | 5prime_partial | 132 | 3-401(+) |
Amino Acid sequence : | |||
LNVLLQIPSPQSTTFNGAGAARPPRHHACPHRLGHRHRHPDRQLRHDRHRFPRQVHHPLVPHQGGPHLRRRPPPPHRPLSLRPGRRPLLRRPVRPLRFLGWRAPPLGPPGRHHRPPLRRP HQGRPLRRLLRR* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,570.001 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 107.417 | ||
aromaticity | 0.030 | ||
GRAVY | -1.273 | ||
Secondary Structure Fraction | |||
Helix | 0.205 | ||
turn | 0.318 | ||
sheet | 0.174 |