| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342429.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TLYDLIMHVLPITNPFHNSPAVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNS SHRSGVDPTDLYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEASFLQTQGEETLELAKEFATNLLYKKLEGTDHEIDNNLLSSIKSALEFPTHWRVQMPNAR SYINV | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,766.156 | ||
| Theoretical pI: | 5.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 47.049 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.245 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342429.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TLYDLIMHVLPITNPFHNSPAVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNS SHRSGVDPTDLYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEASFLQTQGEETLELAKEFATNLLYKKLEGTDHEIDNNLLSSIKSALEFPTHWRVQMPNAR SYINV | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,766.156 | ||
| Theoretical pI: | 5.708 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
| Instability index: | 47.049 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.245 | ||
| sheet | 0.249 | ||