| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342438.1 | 5prime_partial | 170 | 696-184(-) |
Amino Acid sequence : | |||
| RRVLVGGGTPLRPNGNLTVFLFALFNENKKFGPTSERNYGLFYPDERKVYDIPLTAEGLKGYQEAAPPLTGGEQRMVTASGQTWCVAKAEAGKDLLQQGLDFACGEGGADCHPIQPGSTC FDPNPVEAHASYAFNSYYQKKGRAIGTCYFGGAAYMVTQQPKFGKCELPV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 18,412.617 | ||
| Theoretical pI: | 7.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 35.936 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.276 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342438.1 | 5prime_partial | 170 | 696-184(-) |
Amino Acid sequence : | |||
| RRVLVGGGTPLRPNGNLTVFLFALFNENKKFGPTSERNYGLFYPDERKVYDIPLTAEGLKGYQEAAPPLTGGEQRMVTASGQTWCVAKAEAGKDLLQQGLDFACGEGGADCHPIQPGSTC FDPNPVEAHASYAFNSYYQKKGRAIGTCYFGGAAYMVTQQPKFGKCELPV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 18,412.617 | ||
| Theoretical pI: | 7.733 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 35.936 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.276 | ||
| sheet | 0.241 | ||